PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A10G1563
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 292aa    MW: 33287.8 Da    PI: 6.0374
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A10G1563genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.53.6e-192471148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd +l+d+++ +G g+W++ ar+ g++Rt+k+c++rw++yl
      Gh_A10G1563 24 RGPWTVEEDFKLIDYIATHGEGRWNSLARCAGLKRTGKSCRLRWLNYL 71
                     89********************************************97 PP

2Myb_DNA-binding506.8e-1678120246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
      Gh_A10G1563  78 GNITLEEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 120
                      6779*****************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.0031971IPR017930Myb domain
SuperFamilySSF466893.67E-3121118IPR009057Homeodomain-like
SMARTSM007173.8E-162373IPR001005SANT/Myb domain
PfamPF002495.1E-172471IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-232578IPR009057Homeodomain-like
CDDcd001674.72E-132671No hitNo description
PROSITE profilePS5129422.73772126IPR017930Myb domain
SMARTSM007174.2E-1476124IPR001005SANT/Myb domain
PfamPF002491.1E-1478120IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2279125IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009620Biological Processresponse to fungus
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MDVQGRDCVP KAQSSEEDQM ELRRGPWTVE EDFKLIDYIA THGEGRWNSL ARCAGLKRTG  60
KSCRLRWLNY LRPDVRHGNI TLEEQLLILE LHSRWGNRWS KIAQHLPGRT DNEIKNYWRT  120
RVQKHAKQLK CDVNSKQFKD TMRYLWMPRL VERIQAANAA SSTSTAAVTT AVVGTEPMVF  180
PDDHHLGGGA QQVTSSSNNN YTLENSSTTA ASSDSFGTQV SPVSDFADYY SNISINHNPN  240
PNCFEAGNYH NNGLDFQCLE QNNPWLDTVD GSDNIFDAED LYFLQQQFNF NM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-262111824120MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00334DAPTransfer from AT3G06490Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012454768.10.0PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE11e-90MY108_ARATH; Transcription factor MYB108
TrEMBLA0A0D2TAZ60.0A0A0D2TAZ6_G
STRINGPOPTR_0010s15970.11e-131(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06490.11e-86myb domain protein 108